PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI07G09690.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 233aa    MW: 27190.9 Da    PI: 10.2299
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI07G09690.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.54.7e-162973348
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +WT+eEd +l ++ k+ G ++W+++ar m+ +R++ +c++rw+ +l
  OMERI07G09690.1 29 AWTPEEDARLQRLAKENGFRRWSRVARSMP-RRSARSCRDRWRHHL 73
                     7*****************************.***********9886 PP

2Myb_DNA-binding248.8e-08116159348
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      ++T+ +d+ l++++ +lG + Wk I r +  gRt    k+rw+ ++
  OMERI07G09690.1 116 PFTARDDDELLRLHYRLGDR-WKEIGRAVY-GRTSRVMKHRWRELR 159
                      79****************99.********9.***********9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.0842277IPR017930Myb domain
SMARTSM007175.5E-132675IPR001005SANT/Myb domain
CDDcd001671.97E-132973No hitNo description
Gene3DG3DSA:1.10.10.601.7E-192991IPR009057Homeodomain-like
SuperFamilySSF466892.39E-182996IPR009057Homeodomain-like
PfamPF002491.5E-142972IPR001005SANT/Myb domain
SuperFamilySSF466891.61E-1397160IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.5E-498120IPR009057Homeodomain-like
PROSITE profilePS512948.828109163IPR017930Myb domain
SMARTSM007178.4E-4113161IPR001005SANT/Myb domain
CDDcd001673.74E-4116158No hitNo description
PfamPF002497.5E-6116158IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-8121158IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 233 aa     Download sequence    Send to blast
MDQEVIMATP PLTPPPRARC VVRLKLPPAW TPEEDARLQR LAKENGFRRW SRVARSMPRR  60
SARSCRDRWR HHLARDVYHR PFTARDDDEL LRLHYXARSC RDRWRHHLAR DVYHRPFTAR  120
DDDELLRLHY RLGDRWKEIG RAVYGRTSRV MKHRWRELRR GGFLVAAARK EQAIDMVERE  180
VEESADQSLP APELQPSLAD ALASSFGCCI PAHDHAMDPL AGSLALGFAC MVV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C7e-20301609156MYB PROTO-ONCOGENE PROTEIN
1h89_C7e-20301609156MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0052001e-152AP005200.4 Oryza sativa Japonica Group genomic DNA, chromosome 7, PAC clone:P0673E01.
GenBankAP0149631e-152AP014963.1 Oryza sativa Japonica Group DNA, chromosome 7, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645964.11e-110PREDICTED: myb-related protein B-like
TrEMBLA0A0E0EAJ31e-167A0A0E0EAJ3_9ORYZ; Uncharacterized protein
STRINGBGIOSGA024398-PA1e-105(Oryza sativa Indica Group)
STRINGLOC_Os07g25370.11e-105(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP125692035
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23290.18e-18myb domain protein 70